Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 9-2 (TVA92)

This Recombinant Human T cell receptor alpha variable 9-2 (TVA92) spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 9-2 TRAV9-2

UniProt

A0A087WT02

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYRKETTSFHLEKGSVQVSDSAVYFCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mbd1 3'UTR GFP Stable Cell Line
TU262919 1.0 mL

Mbd1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Nori® Guinea Pig S100A10 ELISA Kit
GR171220 96 Well

Nori® Guinea Pig S100A10 ELISA Kit

Sign In for Pricing
View Details
Recombinant ASFV MGF 360-10L Protein (aa 1-353)
VAng-0936Lsx-inquire Inquire

Recombinant ASFV MGF 360-10L Protein (aa 1-353)

Sign In for Pricing
View Details
DiagNano™ Biotin Gold Nanorods, diameter 25 nm, absorption max 700 nm
RFB-25-700 1 mL

DiagNano™ Biotin Gold Nanorods, diameter 25 nm, absorption max 700 nm

Sign In for Pricing
View Details
PRODH shRNA (h) Lentiviral Particles
sc-76252-V 200 µL

PRODH shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
CSNK2A1P Adenovirus (Human)
16950051 1.0 mL

CSNK2A1P Adenovirus (Human)

Sign In for Pricing
View Details