Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-11 (KVD11)

This Recombinant Human Immunoglobulin kappa variable 3D-11 (KVD11) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-11 IGKV3D-11

UniProt

A0A0A0MRZ8

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGPGTDFTLTISSLEPEDFAVYYCQQRSNWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIRT7 (NM_016538) Human Over-expression Lysate
LY402562 100 µg

SIRT7 (NM_016538) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Genomic DNA, Lung
CD563864 5 µg

Tissue Genomic DNA, Lung

Sign In for Pricing
View Details
Goat anti-Mouse IgG (Fc) Polystyrene Particles, 0.5% w/v, 6.0-8.0 µm
MPFc-60-5 5 mL

Goat anti-Mouse IgG (Fc) Polystyrene Particles, 0.5% w/v, 6.0-8.0 µm

Sign In for Pricing
View Details
Goat anti-Mouse IgG Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS
MTB25F4-aM 10x 96 Well Plates

Goat anti-Mouse IgG Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS

Sign In for Pricing
View Details
TAS2R45 Human Gene Knockout Kit (CRISPR)
KN422294 1 Kit

TAS2R45 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/1714), CF740 conjugate, 0.1mg/mL
BNC741714-100 1x 100 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/1714), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details