Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-11 (KVD11)

This Recombinant Human Immunoglobulin kappa variable 3D-11 (KVD11) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-11 IGKV3D-11

UniProt

A0A0A0MRZ8

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGPGTDFTLTISSLEPEDFAVYYCQQRSNWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin Conjugated Rabbit Anti-UEA-I Antibody
BAL-2201-2 2 mL

Biotin Conjugated Rabbit Anti-UEA-I Antibody

Sign In for Pricing
View Details
CRYBB3 (NM_004076) Human Recombinant Protein
TP316611 20 µg

CRYBB3 (NM_004076) Human Recombinant Protein

Sign In for Pricing
View Details
KIF5C Polyclonal Antibody
E-AB-90679-01 60 µL

KIF5C Polyclonal Antibody

Sign In for Pricing
View Details
KIF5C Polyclonal Antibody
E-AB-90679-02 120 µL

KIF5C Polyclonal Antibody

Sign In for Pricing
View Details
KIF5C Polyclonal Antibody
E-AB-90679-03 200 µL

KIF5C Polyclonal Antibody

Sign In for Pricing
View Details
ReadiLink™ Rapid iFluor® 750 Antibody Labeling Kit *Microscale Optimized for Labeling 50 μg Antibody Per Reaction*
1250-AAT 2 Labelings

ReadiLink™ Rapid iFluor® 750 Antibody Labeling Kit *Microscale Optimized for Labeling 50 μg Antibody Per Reaction*

Sign In for Pricing
View Details