Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-11 (KVD11)

This Recombinant Human Immunoglobulin kappa variable 3D-11 (KVD11) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-11 IGKV3D-11

UniProt

A0A0A0MRZ8

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGPGTDFTLTISSLEPEDFAVYYCQQRSNWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MerTK (Innate Immune Checkpoint) (MERTK/3015), CF740 conjugate, 0.1mg/mL
BNC743015-100 1x 100 µL

MerTK (Innate Immune Checkpoint) (MERTK/3015), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant PIST Antibody
RC-15007-01 50 μL

Recombinant PIST Antibody

Sign In for Pricing
View Details
Recombinant PIST Antibody
RC-15007-02 100 µL

Recombinant PIST Antibody

Sign In for Pricing
View Details
Recombinant PIST Antibody
RC-15007-03 1 mL

Recombinant PIST Antibody

Sign In for Pricing
View Details
RNPS1 (NM_080594) Human Recombinant Protein
TP315882L 1 mg

RNPS1 (NM_080594) Human Recombinant Protein

Sign In for Pricing
View Details
MCM6 (Proliferation Marker) (MCM6/3000), 0.2mg/mL
BNUB3000-500 1x 500 µL

MCM6 (Proliferation Marker) (MCM6/3000), 0.2mg/mL

Sign In for Pricing
View Details