Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-11 (KVD11)

This Recombinant Human Immunoglobulin kappa variable 3D-11 (KVD11) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-11 IGKV3D-11

UniProt

A0A0A0MRZ8

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGPGTDFTLTISSLEPEDFAVYYCQQRSNWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Celf2 Rat shRNA Plasmid (Locus ID 29428)
TL710001 1 Kit

Celf2 Rat shRNA Plasmid (Locus ID 29428)

Sign In for Pricing
View Details
Lrp8 (NM_001080926) Mouse Tagged Lenti ORF Clone
MR226275L4 10 µg

Lrp8 (NM_001080926) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti Human Renin Pab
165149 100 µg

Anti Human Renin Pab

Sign In for Pricing
View Details
Human KRT20 ELISA Kit
E021455 1 Each

Human KRT20 ELISA Kit

Sign In for Pricing
View Details
DUSP10 polyclonal antibody
orb1786979-01 50 µL

DUSP10 polyclonal antibody

Sign In for Pricing
View Details
DUSP10 polyclonal antibody
orb1786979-02 100 µL

DUSP10 polyclonal antibody

Sign In for Pricing
View Details