Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 6D-21 (KVD21)

This Recombinant Human Immunoglobulin kappa variable 6D-21 (KVD21) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 6D-21 IGKV6D-21

UniProt

A0A0A0MT36

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPDFQSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAAAYYCHQSSSLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccnl1 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7070904 1.0 µg DNA

Ccnl1 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Mouse SERPIND1 Protein, His Tag
E40MOP1133 20 µg

Mouse SERPIND1 Protein, His Tag

Sign In for Pricing
View Details
Arimoclomol citrate
orb1690567 25 mg

Arimoclomol citrate

Sign In for Pricing
View Details
JM
ABC-TC0478 1 Vial

JM

Sign In for Pricing
View Details
EP3 Double Nickase Plasmid (h)
sc-402485-NIC 20 µg

EP3 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Pack of 50 folded technical filter 150g/m², 650 mm
FT103P0650 Pack of 50

Pack of 50 folded technical filter 150g/m², 650 mm

Sign In for Pricing
View Details