Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 6D-21 (KVD21)

This Recombinant Human Immunoglobulin kappa variable 6D-21 (KVD21) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 6D-21 IGKV6D-21

UniProt

A0A0A0MT36

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPDFQSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAAAYYCHQSSSLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Ets-1 Antibody [PerCP]
NBP2-98794PCP 0.1 mL

Rabbit Polyclonal Ets-1 Antibody [PerCP]

Sign In for Pricing
View Details
SPF45 Polyclonal Antibody
RA34992-01 50 µL

SPF45 Polyclonal Antibody

Sign In for Pricing
View Details
SPF45 Polyclonal Antibody
RA34992-02 100 µL

SPF45 Polyclonal Antibody

Sign In for Pricing
View Details
RAMP2 3'UTR Luciferase Stable Cell Line
TU019485 1.0 mL

RAMP2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SCD1 Recombinant Protein (Mouse)
RP170174 100 µg

SCD1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
OR8G1 ORF Vector (Human) (pORF)
35667011 1.0 µg DNA

OR8G1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details