Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 6D-21 (KVD21)

This Recombinant Human Immunoglobulin kappa variable 6D-21 (KVD21) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 6D-21 IGKV6D-21

UniProt

A0A0A0MT36

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPDFQSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAAAYYCHQSSSLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PPIL4 Recombinant Protein
PROTQ8WUA2-250ug 250 µg

Human PPIL4 Recombinant Protein

Sign In for Pricing
View Details
Imm Antibody
orb819512 2 mg

Imm Antibody

Sign In for Pricing
View Details
Goat C3 Nephritic Factor ELISA Kit
GTR10358961 96 Well

Goat C3 Nephritic Factor ELISA Kit

Sign In for Pricing
View Details
Bovine Amphiphysin (AMPH) ELISA kit
GTR10421428 96 Well

Bovine Amphiphysin (AMPH) ELISA kit

Sign In for Pricing
View Details
CD177 Antigen (CD177) Antibody
abx317990-01 20 µg

CD177 Antigen (CD177) Antibody

Sign In for Pricing
View Details
CD177 Antigen (CD177) Antibody
abx317990-02 50 µg

CD177 Antigen (CD177) Antibody

Sign In for Pricing
View Details