Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-72 (HV372)

This Recombinant Human Immunoglobulin heavy variable 3-72 (HV372) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-72 IGHV3-72

UniProt

A0A0B4J1Y9

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGLEWVGRTRNKANSYTTEYAASVKGRFTISRDDSKNSLYLQMNSLKTEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/3348), CF568 conjugate, 0.1mg/mL
BNC683348-100 1x 100 µL

NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/3348), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Zc3hav1 Mouse Gene Knockout Kit (CRISPR)
KN519650 1 Kit

Zc3hav1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MMP9 (rMMP9/1769), CF594 conjugate, 0.1mg/mL
BNC942176-500 1x 500 µL

MMP9 (rMMP9/1769), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PSME1 Rabbit Monoclonal Antibody [Clone ID: 24GB1505]
TA425152 100 µL

PSME1 Rabbit Monoclonal Antibody [Clone ID: 24GB1505]

Sign In for Pricing
View Details
TPM4 Rabbit Polyclonal Antibody
TA382758 100 µL

TPM4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAM131C Mouse Monoclonal Antibody [Clone ID: OTI1C1]
CF810769 100 µg

FAM131C Mouse Monoclonal Antibody [Clone ID: OTI1C1]

Sign In for Pricing
View Details