Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-72 (HV372)

This Recombinant Human Immunoglobulin heavy variable 3-72 (HV372) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-72 IGHV3-72

UniProt

A0A0B4J1Y9

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGLEWVGRTRNKANSYTTEYAASVKGRFTISRDDSKNSLYLQMNSLKTEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caveolin-3 Recombinant Rabbit Monoclonal Antibody [SY22-06]
ET1607-16 100 µL

Caveolin-3 Recombinant Rabbit Monoclonal Antibody [SY22-06]

Sign In for Pricing
View Details
NIPSNAP1 Rabbit Polyclonal Antibody
TA372849 100 µL

NIPSNAP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Hydroxy-2-(thiophen-2-yl)-2-(thiophen-3-yl)acetic Acid Ethyl Ester (>90%)
TRC-H963550-10MG 10 mg

2-Hydroxy-2-(thiophen-2-yl)-2-(thiophen-3-yl)acetic Acid Ethyl Ester (>90%)

Sign In for Pricing
View Details
SAP30L Rabbit Polyclonal Antibody
TA370742 100 µL

SAP30L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CELF2 (NM_001083591) Human Over-expression Lysate
LY421224 100 µg

CELF2 (NM_001083591) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Human Kappa Light Chain Antibody
KC-074-01 50 μL

Anti-Human Kappa Light Chain Antibody

Sign In for Pricing
View Details