Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-72 (HV372)

This Recombinant Human Immunoglobulin heavy variable 3-72 (HV372) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-72 IGHV3-72

UniProt

A0A0B4J1Y9

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGLEWVGRTRNKANSYTTEYAASVKGRFTISRDDSKNSLYLQMNSLKTEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam71f2 (NM_001101486) Mouse Untagged Clone
MC213233 10 µg

Fam71f2 (NM_001101486) Mouse Untagged Clone

Sign In for Pricing
View Details
PF-477736
B1437-5.1 10 mM (in 1mL DMSO)

PF-477736

Sign In for Pricing
View Details
Isoc2a Mouse siRNA Oligo Duplex (Locus ID 664994)
SR405370 1 Kit

Isoc2a Mouse siRNA Oligo Duplex (Locus ID 664994)

Sign In for Pricing
View Details
Bovine troponin T (Tn-T) ELISA Kit
EIA07551Bo 1 Kit

Bovine troponin T (Tn-T) ELISA Kit

Sign In for Pricing
View Details
MBTPS2 Antibody
MBS8588353-01 0.1 mg

MBTPS2 Antibody

Sign In for Pricing
View Details
MBTPS2 Antibody
MBS8588353-02 0.1 mL (AF405L)

MBTPS2 Antibody

Sign In for Pricing
View Details