Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 5 (TVA5)

This Recombinant Human T cell receptor alpha variable 5 (TVA5) spans the amino acid sequence from region 23-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 5 TRAV5

UniProt

A0A0B4J249

Expression Region

23-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDVEQSLFLSVREGDSSVINCTYTDSSSTYLYWYKQEPGAGLQLLTYIFSNMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac Metanephrine Hydrochloride Salt
TRC-M258760-100MG 100 mg

rac Metanephrine Hydrochloride Salt

Sign In for Pricing
View Details
Human Tetanus Toxoid antibody ELISA KIT
ED0180Hu-01 96 Well

Human Tetanus Toxoid antibody ELISA KIT

Sign In for Pricing
View Details
Human Tetanus Toxoid antibody ELISA KIT
ED0180Hu-02 5x 96 Tests

Human Tetanus Toxoid antibody ELISA KIT

Sign In for Pricing
View Details
Human Tetanus Toxoid antibody ELISA KIT
ED0180Hu-03 10x 96 Tests

Human Tetanus Toxoid antibody ELISA KIT

Sign In for Pricing
View Details
SFRS3, ID (SRSF3, SFRS3, SRP20, Serine/arginine-rich splicing factor 3, Pre-mRNA-splicing factor SRP20, Splicing factor, arginine/serine-rich 3)
041633 200 µL

SFRS3, ID (SRSF3, SFRS3, SRP20, Serine/arginine-rich splicing factor 3, Pre-mRNA-splicing factor SRP20, Splicing factor, arginine/serine-rich 3)

Sign In for Pricing
View Details
ZNF699 Human shRNA Lentiviral Particle (Locus ID 374879)
TL318706V 500 µL Each

ZNF699 Human shRNA Lentiviral Particle (Locus ID 374879)

Sign In for Pricing
View Details