Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 5 (TVA5)

This Recombinant Human T cell receptor alpha variable 5 (TVA5) spans the amino acid sequence from region 23-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 5 TRAV5

UniProt

A0A0B4J249

Expression Region

23-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDVEQSLFLSVREGDSSVINCTYTDSSSTYLYWYKQEPGAGLQLLTYIFSNMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donkey anti-Goat IgG (H&L), Biotin conjugated
AS10 1305 2 mg

Donkey anti-Goat IgG (H&L), Biotin conjugated

Sign In for Pricing
View Details
Human NLR Family, Pyrin Domain Containing Protein 3 (NLRP3) ELISA Kit
orb779257-01 48 Tests

Human NLR Family, Pyrin Domain Containing Protein 3 (NLRP3) ELISA Kit

Sign In for Pricing
View Details
Human NLR Family, Pyrin Domain Containing Protein 3 (NLRP3) ELISA Kit
orb779257-02 96 Tests

Human NLR Family, Pyrin Domain Containing Protein 3 (NLRP3) ELISA Kit

Sign In for Pricing
View Details
IDH3A CRISPR Knock Out 293T Cell Line (Human)
24189141 1x 10^6 Cells / 1.0 mL

IDH3A CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
SNU13 Antibody - N-terminal region
ARP40236_P050-25UL 25 µL

SNU13 Antibody - N-terminal region

Sign In for Pricing
View Details
Mouse Monoclonal katanin-p80 Antibody (OTI5C4) - Azide and BSA Free
NBP2-71578 100 µg

Mouse Monoclonal katanin-p80 Antibody (OTI5C4) - Azide and BSA Free

Sign In for Pricing
View Details