Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 5 (TVA5)

This Recombinant Human T cell receptor alpha variable 5 (TVA5) spans the amino acid sequence from region 23-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 5 TRAV5

UniProt

A0A0B4J249

Expression Region

23-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDVEQSLFLSVREGDSSVINCTYTDSSSTYLYWYKQEPGAGLQLLTYIFSNMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DKK3 Antibody
A71105-100UG 100 µg

DKK3 Antibody

Sign In for Pricing
View Details
Recombinant IMPDH2 Antibody
RC-15958-01 50 μL

Recombinant IMPDH2 Antibody

Sign In for Pricing
View Details
Recombinant IMPDH2 Antibody
RC-15958-02 100 µL

Recombinant IMPDH2 Antibody

Sign In for Pricing
View Details
Recombinant IMPDH2 Antibody
RC-15958-03 1 mL

Recombinant IMPDH2 Antibody

Sign In for Pricing
View Details
Stathmin 1 / Oncoprotein 18 Antibody
abx115844 100 µL

Stathmin 1 / Oncoprotein 18 Antibody

Sign In for Pricing
View Details
MFF CRISPRa sgRNA lentivector (set of three targets)(Rat)
28440126 3x 1.0µg DNA

MFF CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details