Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 5 (TVA5)

This Recombinant Human T cell receptor alpha variable 5 (TVA5) spans the amino acid sequence from region 23-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 5 TRAV5

UniProt

A0A0B4J249

Expression Region

23-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDVEQSLFLSVREGDSSVINCTYTDSSSTYLYWYKQEPGAGLQLLTYIFSNMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat inducible nitric oxide synthase (iNOS) ELISA Kit
201-11-0741 96 Tests

Rat inducible nitric oxide synthase (iNOS) ELISA Kit

Sign In for Pricing
View Details
SEMA3B Protein Vector (Rat) (pPB-N-His)
PV303999 500 ng

SEMA3B Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS513558 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
GRPEL2P2 Protein Vector (Human) (pPB-N-His)
PV081770 500 ng

GRPEL2P2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Acsl3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
11215114 3x 1.0 µg

Acsl3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
CZC-8004
bs-82635C-01 5 mg

CZC-8004

Sign In for Pricing
View Details