Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 17 (TVA17)

This Recombinant Human T cell receptor alpha variable 17 (TVA17) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 17 TRAV17

UniProt

A0A0B4J275

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQGEEDPQALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFRS3 Recombinant Rabbit Monoclonal Antibody [JE46-44]
ET7109-47 100 µL

SFRS3 Recombinant Rabbit Monoclonal Antibody [JE46-44]

Sign In for Pricing
View Details
2,4,6-Trichloropyrimidine
TRC-T774180-25G 25 g

2,4,6-Trichloropyrimidine

Sign In for Pricing
View Details
HnRNP F Antibody
8C10700-AAT 50 µg

HnRNP F Antibody

Sign In for Pricing
View Details
CASC3 (NM_007359) Human Recombinant Protein
TP308495L 1 mg

CASC3 (NM_007359) Human Recombinant Protein

Sign In for Pricing
View Details
Wdr46 Mouse Gene Knockout Kit (CRISPR)
KN519363 1 Kit

Wdr46 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
B4GAT1 Rabbit Polyclonal Antibody
TA372091 100 µL

B4GAT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details