Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 17 (TVA17)

This Recombinant Human T cell receptor alpha variable 17 (TVA17) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 17 TRAV17

UniProt

A0A0B4J275

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQGEEDPQALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAMK2A Rabbit Polyclonal Antibody
TA367933 100 µL

CAMK2A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (LAMP4/1830), CF594 conjugate, 0.1mg/mL
BNC941830-100 1x 100 µL

CD68 (Macrophage Marker) (LAMP4/1830), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KRT6A (NM_005554) Human Recombinant Protein
TP760092 50 µg

KRT6A (NM_005554) Human Recombinant Protein

Sign In for Pricing
View Details
BAX Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C8]
TA810335BM 100 µL

BAX Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C8]

Sign In for Pricing
View Details
SIGIRR (NM_001135053) Human Over-expression Lysate
LY427540 100 µg

SIGIRR (NM_001135053) Human Over-expression Lysate

Sign In for Pricing
View Details
Mix-n-StainTM CF®405L IgM Antibody Labeling Kits, 1x100ug labeling
#92559 1 Kit

Mix-n-StainTM CF®405L IgM Antibody Labeling Kits, 1x100ug labeling

Sign In for Pricing
View Details