Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 6D-41 (KVD41)

This Recombinant Human Probable non-functional immunoglobulin kappa variable 6D-41 (KVD41) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 6D-41 IGKV6D-41

UniProt

A0A0C4DH26

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DVVMTQSPAFLSVTPGEKVTITCQASEGIGNYLYWYQQKPDQAPKLLIKYASQSISGVPSRFSGSGSGTDFTFTISSLEAEDAATYYCQQGNKHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Testis
CR562159 5 µg

Tissue Total RNA, Testis

Sign In for Pricing
View Details
LCP EZ-Cut films (50 pieces, with liners)
MLCP-EZCTF-50 50 Films

LCP EZ-Cut films (50 pieces, with liners)

Sign In for Pricing
View Details
Brinp3 Rat shRNA Plasmid (Locus ID 286901)
TR713348 1 Kit

Brinp3 Rat shRNA Plasmid (Locus ID 286901)

Sign In for Pricing
View Details
NOL4 Rabbit Polyclonal Antibody
MBS9515759-01 0.05 mL

NOL4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NOL4 Rabbit Polyclonal Antibody
MBS9515759-02 0.1 mL

NOL4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NOL4 Rabbit Polyclonal Antibody
MBS9515759-03 5x 0.1 mL

NOL4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details