Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 5-51 (HV551)

This Recombinant Human Immunoglobulin heavy variable 5-51 (HV551) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 5-51 IGHV5-51

UniProt

A0A0C4DH38

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pelanserin Free Base
orb1739677-01 25 mg

Pelanserin Free Base

Sign In for Pricing
View Details
Pelanserin Free Base
orb1739677-02 50 mg

Pelanserin Free Base

Sign In for Pricing
View Details
Pelanserin Free Base
orb1739677-03 100 mg

Pelanserin Free Base

Sign In for Pricing
View Details
GPR133 Double Nickase Plasmid (m)
sc-433963-NIC 20 µg

GPR133 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
RPS26P53 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
42342061 1.0 µg DNA

RPS26P53 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
SALL1 Rabbit Polyclonal Antibody (APC-Cy7)
orb2536758 100 µL

SALL1 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details