Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 5-51 (HV551)

This Recombinant Human Immunoglobulin heavy variable 5-51 (HV551) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 5-51 IGHV5-51

UniProt

A0A0C4DH38

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Aeromonas Salmonicida leuA Protein
VAng-Lsx1321-inquire Inquire

Recombinant Aeromonas Salmonicida leuA Protein

Sign In for Pricing
View Details
Human CFLAR knockout cell line
ABC-KH2987 1 Vial

Human CFLAR knockout cell line

Sign In for Pricing
View Details
CfrI discontinued
C3200-01 200 U

CfrI discontinued

Sign In for Pricing
View Details
CfrI discontinued
C3200-02 1000 U

CfrI discontinued

Sign In for Pricing
View Details
SYNRG (NM_001163547) Human Tagged Lenti ORF Clone
RC229063L4 10 µg

SYNRG (NM_001163547) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
NME7 Human Pre-designed siRNA Set A
HY-RS09378 1 Set

NME7 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details