Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-12 (KV112)

This Recombinant Human Immunoglobulin kappa variable 1-12 (KV112) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-12 IGKV1-12

UniProt

A0A0C4DH73

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQANSFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXR1 Antibody
8C15804-AAT 50 µg

FOXR1 Antibody

Sign In for Pricing
View Details
Grik4 Mouse Gene Knockout Kit (CRISPR)
KN307327LP 1 Kit

Grik4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
p53 (TP53) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: DO-1]
TA804804AM 100 µL

p53 (TP53) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: DO-1]

Sign In for Pricing
View Details
RRAS Mouse Monoclonal Antibody [Clone ID: OTI2B7]
CF809505 100 µg

RRAS Mouse Monoclonal Antibody [Clone ID: OTI2B7]

Sign In for Pricing
View Details
Elagolix-d6 Sodium Salt (Major)
TRC-E501014-1MG 1 mg

Elagolix-d6 Sodium Salt (Major)

Sign In for Pricing
View Details
CD23 (Fc Epsilon RII) (FCER2/3592), CF740 conjugate, 0.1mg/mL
BNC743592-100 1x 100 µL

CD23 (Fc Epsilon RII) (FCER2/3592), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details