Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-12 (KV112)

This Recombinant Human Immunoglobulin kappa variable 1-12 (KV112) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-12 IGKV1-12

UniProt

A0A0C4DH73

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQANSFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trypsin Inhibitor DE-3 Polyclonal Antibody
A64518-100 100 µL

Trypsin Inhibitor DE-3 Polyclonal Antibody

Sign In for Pricing
View Details
FITC conjugated antibody to FASLG Antibody (MOFY-0722-FY438)
MOFY-0722-FY438 Each

FITC conjugated antibody to FASLG Antibody (MOFY-0722-FY438)

Sign In for Pricing
View Details
Vinculin (VCL, VINC, VIN 1, Metavinculin, MVCL) discontinued
V2122-63D 100 µL

Vinculin (VCL, VINC, VIN 1, Metavinculin, MVCL) discontinued

Sign In for Pricing
View Details
Factor XIIIa (F13A1) Mouse Monoclonal Antibody [Clone ID: LBI1H2]
AMM14513VCF 100 µg

Factor XIIIa (F13A1) Mouse Monoclonal Antibody [Clone ID: LBI1H2]

Sign In for Pricing
View Details
Adra2b AAV siRNA Pooled Vector
11447166 1.0 µg

Adra2b AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Rabbit anti-Drosophila yakuba (Fruit fly) kay Polyclonal Antibody
MBS7170985 Inquire

Rabbit anti-Drosophila yakuba (Fruit fly) kay Polyclonal Antibody

Sign In for Pricing
View Details