Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-1 (TVB61)

This Recombinant Human T cell receptor beta variable 6-1 (TVB61) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-1 TRBV6-1

UniProt

A0A0K0K1D8

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desmosteryl Sulfate Sodium Salt
TRC-D432502-5MG 5 mg

Desmosteryl Sulfate Sodium Salt

Sign In for Pricing
View Details
WNT3A (NM_033131) Human Over-expression Lysate
LC403226 20 µg

WNT3A (NM_033131) Human Over-expression Lysate

Sign In for Pricing
View Details
MST1 (STK4) (NM_006282) Human Over-expression Lysate
LY401893 100 µg

MST1 (STK4) (NM_006282) Human Over-expression Lysate

Sign In for Pricing
View Details
B7-2 (CD86) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8A7]
TA813085BM 100 µL

B7-2 (CD86) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8A7]

Sign In for Pricing
View Details
Sortilin / NT3 Recombinant Rabbit monoclonal Antibody
HA751054 100 µL

Sortilin / NT3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Dihydro Ferulic Acid
TRC-D448900-500MG 500 mg

Dihydro Ferulic Acid

Sign In for Pricing
View Details