Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-1 (TVB61)

This Recombinant Human T cell receptor beta variable 6-1 (TVB61) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-1 TRBV6-1

UniProt

A0A0K0K1D8

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(17Beta)-Spiro[androsta-1,4-diene-17,2'-oxiran]-3-one
TRC-S682970-10MG 10 mg

(17Beta)-Spiro[androsta-1,4-diene-17,2'-oxiran]-3-one

Sign In for Pricing
View Details
GIPC (GIPC1) Mouse Monoclonal Antibody [Clone ID: OTI4C11]
CF811914 100 µg

GIPC (GIPC1) Mouse Monoclonal Antibody [Clone ID: OTI4C11]

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (rEGP40/1372), CF405S conjugate, 0.1mg/mL
BNC042172-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (rEGP40/1372), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Aurora B (Proliferation Marker) (AURKB/1593), CF740 conjugate, 0.1mg/mL
BNC741593-100 1x 100 µL

Aurora B (Proliferation Marker) (AURKB/1593), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SEMA5B (NM_001031702) Human Over-expression Lysate
LC422156 20 µg

SEMA5B (NM_001031702) Human Over-expression Lysate

Sign In for Pricing
View Details
Cyclin G (CCNG1) Human Gene Knockout Kit (CRISPR)
KN400001 1 Kit

Cyclin G (CCNG1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details