Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-8 (TVB78)

This Recombinant Human T cell receptor beta variable 7-8 (TVB78) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-8 TRBV7-8

UniProt

A0A1B0GX51

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVAKRGQDVALRCDPISGHVSLFWYQQALGQGPEFLTYFQNEAQLDKSGLPSDRFFAERPEGSVSTLKIQRTQQEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF268 Lentiviral Activation Particles (h2)
sc-411514-LAC-2 200 µL

ZNF268 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Recombinant Human CELF3 Protein
E30P65765A 50 µg

Recombinant Human CELF3 Protein

Sign In for Pricing
View Details
Anti-SARS-CoV-2 Nucleocapsid Antibody (5T877)
TMAY-02954-01 20 µL

Anti-SARS-CoV-2 Nucleocapsid Antibody (5T877)

Sign In for Pricing
View Details
Anti-SARS-CoV-2 Nucleocapsid Antibody (5T877)
TMAY-02954-02 100 µL

Anti-SARS-CoV-2 Nucleocapsid Antibody (5T877)

Sign In for Pricing
View Details
Recombinant Human HN-1/ ARM2 Protein, His, Yeast-10ug
QP8233-ye-10ug 10ug

Recombinant Human HN-1/ ARM2 Protein, His, Yeast-10ug

Sign In for Pricing
View Details
PEX5 (NM_001131023) Human Tagged ORF Clone Lentiviral Particle
RC226067L3V 200 µL

PEX5 (NM_001131023) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details