Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H2B type 2-K1 (H2BK1)

This Recombinant Human Histone H2B type 2-K1 (H2BK1) spans the amino acid sequence from region 2-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H2B type 2-K1; Histone H2B type 2-E1; H2BK1 H2BE1

UniProt

A0A2R8Y619

Expression Region

2-122

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SAEYGQRQQPGGRGGRSSGNKKSKKRCRRKESYSMYIYKVLKQVHPDIGISAKAMSIMNSFVNDVFEQLACEAARLAQYSGRTTLTSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

InVivoMAb Mouse IL11RA Antibody
orb3152309-01 100 µg

InVivoMAb Mouse IL11RA Antibody

Sign In for Pricing
View Details
InVivoMAb Mouse IL11RA Antibody
orb3152309-02 1 mg

InVivoMAb Mouse IL11RA Antibody

Sign In for Pricing
View Details
KDM6B Human Gene Knockout Kit (CRISPR)
KN419461 1 Kit

KDM6B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IgG, H&L (FITC)
I1903-31 500 µL

IgG, H&L (FITC)

Sign In for Pricing
View Details
IKK alpha/beta Rabbit Monoclonal Antibody
AMRe03967-01 50 µL

IKK alpha/beta Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
IKK alpha/beta Rabbit Monoclonal Antibody
AMRe03967-02 100 µL

IKK alpha/beta Rabbit Monoclonal Antibody

Sign In for Pricing
View Details