Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H2B type 2-K1 (H2BK1)

This Recombinant Human Histone H2B type 2-K1 (H2BK1) spans the amino acid sequence from region 2-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H2B type 2-K1; Histone H2B type 2-E1; H2BK1 H2BE1

UniProt

A0A2R8Y619

Expression Region

2-122

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SAEYGQRQQPGGRGGRSSGNKKSKKRCRRKESYSMYIYKVLKQVHPDIGISAKAMSIMNSFVNDVFEQLACEAARLAQYSGRTTLTSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC48A1 Double Nickase Plasmid (m2)
sc-426721-NIC-2 20 µg

SLC48A1 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Pou4f2-set siRNA/shRNA/RNAi Lentivector (Rat)
37266096 4x 500 ng

Pou4f2-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
COMMD1 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-8034R-PerCP-Cy5.5 100 µL

COMMD1 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
JRK (NM_001077527) Human Tagged Lenti ORF Clone
RC218013L4 10 µg

JRK (NM_001077527) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GTF2B Antibody
orb1244287 100 µL

GTF2B Antibody

Sign In for Pricing
View Details
P/P013/NL294/TWM-148X210-1 Prohibited Activity Signs & Labels (Adhesive)
234014 1 Pack (1 Panel (s) x 1 Pack)

P/P013/NL294/TWM-148X210-1 Prohibited Activity Signs & Labels (Adhesive)

Sign In for Pricing
View Details