Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 11-2 (TVBK2)

This Recombinant Human T cell receptor beta variable 11-2 (TVBK2) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 11-2 TRBV11-2 TCRBV21S3A2N2T

UniProt

A0A584

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQGPKLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MycAway™ Plus-Color One-Step Mycoplasma Detection Kit (2G)
40615ES08 5 Tests

MycAway™ Plus-Color One-Step Mycoplasma Detection Kit (2G)

Sign In for Pricing
View Details
Anti-Wnt1 Inducible Signaling Pathway Protein 2 (WISP2)
FY-AB44853-01 1 mL

Anti-Wnt1 Inducible Signaling Pathway Protein 2 (WISP2)

Sign In for Pricing
View Details
Anti-Wnt1 Inducible Signaling Pathway Protein 2 (WISP2)
FY-AB44853-02 100 µL

Anti-Wnt1 Inducible Signaling Pathway Protein 2 (WISP2)

Sign In for Pricing
View Details
Anti-Wnt1 Inducible Signaling Pathway Protein 2 (WISP2)
FY-AB44853-03 200 µL

Anti-Wnt1 Inducible Signaling Pathway Protein 2 (WISP2)

Sign In for Pricing
View Details
Recombinant Drosophila erecta ATPase ASNA1 homolog (GG10733)
MBS1229242-01 0.02 mg (E-Coli)

Recombinant Drosophila erecta ATPase ASNA1 homolog (GG10733)

Sign In for Pricing
View Details
Recombinant Drosophila erecta ATPase ASNA1 homolog (GG10733)
MBS1229242-02 0.02 mg (Yeast)

Recombinant Drosophila erecta ATPase ASNA1 homolog (GG10733)

Sign In for Pricing
View Details