Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein SHMOOSE (SHMOS)

This Recombinant Human Protein SHMOOSE (SHMOS) spans the amino acid sequence from region 1-58. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein SHMOOSE; Small human mitochondrial ORF over serine tRNA

UniProt

C0HM83

Expression Region

1-58

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPPCLTTWLSQLLKDNSYPLVLGPKNFGATPNKSNNHAHYYNHPNPDFPNSPHPYHPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MTHFD2L Protein - (Dry Ice)
H00441024-P01-10ug 10 µg

Recombinant Human MTHFD2L Protein - (Dry Ice)

Sign In for Pricing
View Details
Rheostats, Sliding Contact, Open Type, Single Tube
1090980/8C 1 Each

Rheostats, Sliding Contact, Open Type, Single Tube

Sign In for Pricing
View Details
Recombinant Streptococcus Thermophilus rplS Protein (aa 1-115)
VAng-Cr8435-500gEcoli 500 µg (E. coli)

Recombinant Streptococcus Thermophilus rplS Protein (aa 1-115)

Sign In for Pricing
View Details
ID3 Antibody (C-term)
orb165363-01 50 µL

ID3 Antibody (C-term)

Sign In for Pricing
View Details
ID3 Antibody (C-term)
orb165363-02 100 µL

ID3 Antibody (C-term)

Sign In for Pricing
View Details
Recombinant Salmonella schwarzengrund Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)
orb2921841-01 20 µg

Recombinant Salmonella schwarzengrund Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Sign In for Pricing
View Details