Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein SHMOOSE (SHMOS)

This Recombinant Human Protein SHMOOSE (SHMOS) spans the amino acid sequence from region 1-58. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein SHMOOSE; Small human mitochondrial ORF over serine tRNA

UniProt

C0HM83

Expression Region

1-58

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPPCLTTWLSQLLKDNSYPLVLGPKNFGATPNKSNNHAHYYNHPNPDFPNSPHPYHPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO10 Rabbit pAb
E45R21423N 50 ul

FBXO10 Rabbit pAb

Sign In for Pricing
View Details
Rpl11 (BC021402) Mouse Recombinant Protein
TP501377 20 µg

Rpl11 (BC021402) Mouse Recombinant Protein

Sign In for Pricing
View Details
Lrrc68 3'UTR Luciferase Stable Cell Line
TU212598 1.0 mL

Lrrc68 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
H2al1k Mouse shRNA Plasmid (Locus ID 547154)
TR518306 1 Kit

H2al1k Mouse shRNA Plasmid (Locus ID 547154)

Sign In for Pricing
View Details
RANK (TNFRSF11A) (NM_001270950) Human Untagged Clone
SC333013 10 µg

RANK (TNFRSF11A) (NM_001270950) Human Untagged Clone

Sign In for Pricing
View Details
HDAC9 Conjugated Antibody
MBS9457309-01 0.1 mL (Biotin)

HDAC9 Conjugated Antibody

Sign In for Pricing
View Details