Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein SHMOOSE (SHMOS)

This Recombinant Human Protein SHMOOSE (SHMOS) spans the amino acid sequence from region 1-58. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein SHMOOSE; Small human mitochondrial ORF over serine tRNA

UniProt

C0HM83

Expression Region

1-58

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPPCLTTWLSQLLKDNSYPLVLGPKNFGATPNKSNNHAHYYNHPNPDFPNSPHPYHPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Heparan sulfate 6 O sulfotransferase 3 (HS6ST3) ELISA Kit
GTR10329920 96 Well

Human Heparan sulfate 6 O sulfotransferase 3 (HS6ST3) ELISA Kit

Sign In for Pricing
View Details
Epstein-Barr Virus LMP2A Antibody
GWB-41C4D6 0.25 mg

Epstein-Barr Virus LMP2A Antibody

Sign In for Pricing
View Details
Hepatitis Be Ag (HBeAg) (FITC) discontinued
H1915-10J-FITC 100 µL

Hepatitis Be Ag (HBeAg) (FITC) discontinued

Sign In for Pricing
View Details
Laminin 5 (LAMB3) (NM_000228) Human Over-expression Lysate
LS003914 100 µg

Laminin 5 (LAMB3) (NM_000228) Human Over-expression Lysate

Sign In for Pricing
View Details
HBV-IN-29
HY-148780 1 Each

HBV-IN-29

Sign In for Pricing
View Details
Human Carcinoembryonic antigen-related cell adhesion molecule 5 ELISA Kit
EK1391 Inquire

Human Carcinoembryonic antigen-related cell adhesion molecule 5 ELISA Kit

Sign In for Pricing
View Details