Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-30-5 (HVC05)

This Recombinant Human Immunoglobulin heavy variable 3-30-5 (HVC05) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-30-5 IGHV3-30-5

UniProt

P0DP03

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUX1 Protein Vector (Human) (pPB-N-His)
PV074298 500 ng

DUX1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
OR1B1 (Olfactory Receptor 1B1, Olfactory Receptor 9-B, OR9-B, Olfactory Receptor OR9-26, OR1B1)
381670 200 µL

OR1B1 (Olfactory Receptor 1B1, Olfactory Receptor 9-B, OR9-B, Olfactory Receptor OR9-26, OR1B1)

Sign In for Pricing
View Details
DTYMK Antibody (C-term) Blocking Peptide
MBS9226543-01 0.5 mg

DTYMK Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
DTYMK Antibody (C-term) Blocking Peptide
MBS9226543-02 5x 0.5 mg

DTYMK Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
Cyclohexene-d10
sc-227709 5 g

Cyclohexene-d10

Sign In for Pricing
View Details
TMEM106C Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV657633 1.0 µg DNA

TMEM106C Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details