Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-3 (TVB63)

This Recombinant Human T cell receptor beta variable 6-3 (TVB63) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-3 TRBV6-3

UniProt

P0DPF7

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAb to Adiponectin
MBS312870-01 1 mg

MAb to Adiponectin

Sign In for Pricing
View Details
MAb to Adiponectin
MBS312870-02 5x 1 mg

MAb to Adiponectin

Sign In for Pricing
View Details
Anti-Melanotransferrin / CD228
A2402-1mg 1 mg

Anti-Melanotransferrin / CD228

Sign In for Pricing
View Details
Pep2-8
112176 1.0mg

Pep2-8

Sign In for Pricing
View Details
Rabbit vitronectin, VNR ELISA Kit
MBS1609214 96 Well

Rabbit vitronectin, VNR ELISA Kit

Sign In for Pricing
View Details
Human CD140b/PDGFRB Antibody , APC
E55A08199 50 Tests

Human CD140b/PDGFRB Antibody , APC

Sign In for Pricing
View Details