Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-3 (TVB63)

This Recombinant Human T cell receptor beta variable 6-3 (TVB63) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-3 TRBV6-3

UniProt

P0DPF7

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akt1 Polyclonal Antibody
JOT-AP00346-01 20 µL

Akt1 Polyclonal Antibody

Sign In for Pricing
View Details
Akt1 Polyclonal Antibody
JOT-AP00346-02 50 μL

Akt1 Polyclonal Antibody

Sign In for Pricing
View Details
Akt1 Polyclonal Antibody
JOT-AP00346-03 100 µL

Akt1 Polyclonal Antibody

Sign In for Pricing
View Details
GLRA1 Protein Vector (Rat) (pPM-C-His)
PV270409 500 ng

GLRA1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Proline-Rich Acidic Protein 1, aa58-69 (PRAP1, MGC126792, PRO1195, RP11-122K13.6, UNQ608/PRO1195, UPA, Uterine-specific proline-rich acidic protein)
MBS621736-01 0.02 mL

Proline-Rich Acidic Protein 1, aa58-69 (PRAP1, MGC126792, PRO1195, RP11-122K13.6, UNQ608/PRO1195, UPA, Uterine-specific proline-rich acidic protein)

Sign In for Pricing
View Details
Proline-Rich Acidic Protein 1, aa58-69 (PRAP1, MGC126792, PRO1195, RP11-122K13.6, UNQ608/PRO1195, UPA, Uterine-specific proline-rich acidic protein)
MBS621736-02 0.1 mL

Proline-Rich Acidic Protein 1, aa58-69 (PRAP1, MGC126792, PRO1195, RP11-122K13.6, UNQ608/PRO1195, UPA, Uterine-specific proline-rich acidic protein)

Sign In for Pricing
View Details