Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cysteine-rich and transmembrane domain-containing protein 1 (CYTM1), partial

This Recombinant Human Cysteine-rich and transmembrane domain-containing protein 1 (CYTM1), partial spans the amino acid sequence from region 1-73. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cysteine-rich and transmembrane domain-containing protein 1 CYSTM1 C5orf32 ORF1-FL49

UniProt

Q9H1C7

Expression Region

1-73

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNQENPPPYPGPGPTAPYPPYPPQPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQRRDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Insulin, INS ELISA Kit
CK-bio-18854-01 48 Tests

Canine Insulin, INS ELISA Kit

Sign In for Pricing
View Details
Canine Insulin, INS ELISA Kit
CK-bio-18854-02 96 Tests

Canine Insulin, INS ELISA Kit

Sign In for Pricing
View Details
Canine Insulin, INS ELISA Kit
CK-bio-18854-03 5x 96 Tests

Canine Insulin, INS ELISA Kit

Sign In for Pricing
View Details
Canine Insulin, INS ELISA Kit
CK-bio-18854-04 10x 96 Tests

Canine Insulin, INS ELISA Kit

Sign In for Pricing
View Details
6-Chloroisoquinoline
OR300089-01 1 g

6-Chloroisoquinoline

Sign In for Pricing
View Details
6-Chloroisoquinoline
OR300089-02 5 g

6-Chloroisoquinoline

Sign In for Pricing
View Details