Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein KIF25-AS1 (KIAS1)

This Recombinant Human Putative uncharacterized protein KIF25-AS1 (KIAS1) spans the amino acid sequence from region 1-181. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein KIF25-AS1; KIF25 antisense RNA 1; KIF25 antisense gene protein 1; Protein HGC6.1; KIF25-AS1 C6orf54 NCRNA00300

UniProt

Q9Y6Z4

Expression Region

1-181

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGDIFKNNGVLQGRLRAVACAPHCFGPRLRCLHHDQGLTELAWGTWPHSHPVRHQPQMPSARECCSIVCMAAKEVSAPKAPGSPWMVPGDVAMSGHRVGALDERGHPNPQTGHCRGGSVSVTWSSVSCCRGRLAAVRVMIARDPSTCHLAKGCSPAWGFLPQARGPAGTRTPQRRCSSHEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rb (RB1) pSer780 Rabbit Polyclonal Antibody
AP01675PU-N 100 µg

Rb (RB1) pSer780 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
7-Hydroxy-3-oxo-Cholest-4-en-26-oic Acid
TRC-H949660-25MG 25 mg

7-Hydroxy-3-oxo-Cholest-4-en-26-oic Acid

Sign In for Pricing
View Details
CAP2 Polyclonal Antibody
E-AB-13963-01 20 µL

CAP2 Polyclonal Antibody

Sign In for Pricing
View Details
CAP2 Polyclonal Antibody
E-AB-13963-02 60 µL

CAP2 Polyclonal Antibody

Sign In for Pricing
View Details
CAP2 Polyclonal Antibody
E-AB-13963-03 120 µL

CAP2 Polyclonal Antibody

Sign In for Pricing
View Details
CAP2 Polyclonal Antibody
E-AB-13963-04 200 µL

CAP2 Polyclonal Antibody

Sign In for Pricing
View Details