Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 51 (TEX51), partial

This Recombinant Human Testis-expressed protein 51 (TEX51), partial spans the amino acid sequence from region 16-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 51 TEX51

UniProt

A0A1B0GUA7

Expression Region

16-137

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KNCLRCWPELSALIDYDLQILWVTPGPPTELSQNRDHLEEETAKFFTQVHQAIKTLRDDKTVLLEEIYTHKNLFTERLNKISDGLKEKDIQSTLKVTSCADCRTHFLSCNDPTFCPARNRRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S-Acebutolol
464983-01 25 mg

S-Acebutolol

Sign In for Pricing
View Details
S-Acebutolol
464983-02 50 mg

S-Acebutolol

Sign In for Pricing
View Details
Anti-IMPA1 Antibody Picoband® Fluoro488 Conjugated
A05882-2-Fluoro488 100 µg/Vial

Anti-IMPA1 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
TNF-alpha (Tumor necrosis factor alpha) BioAssayTM ELISA Kit (Porcine) discontinued
359344-01 48 Tests

TNF-alpha (Tumor necrosis factor alpha) BioAssayTM ELISA Kit (Porcine) discontinued

Sign In for Pricing
View Details
TNF-alpha (Tumor necrosis factor alpha) BioAssayTM ELISA Kit (Porcine) discontinued
359344-02 96 Tests

TNF-alpha (Tumor necrosis factor alpha) BioAssayTM ELISA Kit (Porcine) discontinued

Sign In for Pricing
View Details
(1S,2R) - (+) -N-Acetyl Ephedrine
CS-T-47234 1 Each

(1S,2R) - (+) -N-Acetyl Ephedrine

Sign In for Pricing
View Details