Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Parvalbumin-like EF-hand-containing protein (PVLEF)

This Recombinant Human Parvalbumin-like EF-hand-containing protein (PVLEF) spans the amino acid sequence from region 1-134. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Parvalbumin-like EF-hand-containing protein PVALEF

UniProt

A0A1B0GWK0

Expression Region

1-134

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEEDFSSQMKKMALAMGTSLSDKDIELLPTDMRHHGSFNYLKFFKHIRKLHASGQLDDAIHTAFQSLDKDKSGFIEWNEIKYILSIIPSSGPTTPLTDEEAEAMIQAADTHGDGRINYEEFSELIKKEKIPKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL
BNC741003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL
BNC680978-500 1x 500 µL

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin B1 (V92.1), CF647 conjugate, 0.1mg/mL
BNC470680-500 1x 500 µL

Cyclin B1 (V92.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (124), CF568 conjugate, 0.1mg/mL
BNC680530-100 1x 100 µL

Bcl-2 (124), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/2580), CF488A conjugate, 0.1mg/mL
BNC882580-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/2580), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF568 conjugate, 0.1mg/mL
BNC681025-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details