Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Parvalbumin-like EF-hand-containing protein (PVLEF)

This Recombinant Human Parvalbumin-like EF-hand-containing protein (PVLEF) spans the amino acid sequence from region 1-134. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Parvalbumin-like EF-hand-containing protein PVALEF

UniProt

A0A1B0GWK0

Expression Region

1-134

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEEDFSSQMKKMALAMGTSLSDKDIELLPTDMRHHGSFNYLKFFKHIRKLHASGQLDDAIHTAFQSLDKDKSGFIEWNEIKYILSIIPSSGPTTPLTDEEAEAMIQAADTHGDGRINYEEFSELIKKEKIPKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERK1 Polyclonal Antibody, HRP Conjugated
bs-1020R-HRP 100 µL

ERK1 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
PRYP3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1735505 3x 1.0 µg

PRYP3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
EPDR/EPDR1 Rabbit anti-Human Polyclonal Antibody
MBS2404034-01 0.6 mL

EPDR/EPDR1 Rabbit anti-Human Polyclonal Antibody

Sign In for Pricing
View Details
EPDR/EPDR1 Rabbit anti-Human Polyclonal Antibody
MBS2404034-02 5x 0.06 mL

EPDR/EPDR1 Rabbit anti-Human Polyclonal Antibody

Sign In for Pricing
View Details
WWC1 Protein Vector (Mouse) (pPM-C-His)
PV247689 500 ng

WWC1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
NucleoMag Plant 384
MN 744402.4 1536 Preparations

NucleoMag Plant 384

Sign In for Pricing
View Details