Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 46 (TEX46), partial

This Recombinant Human Testis-expressed protein 46 (TEX46), partial spans the amino acid sequence from region 37-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 46 TEX46 C1orf234

UniProt

H3BTG2

Expression Region

37-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LSNWLVKYEHKLTLPEPQQDEILQRLLFSEMKMKVLENQMFIIWNKMNHHGRSSRHRNFPMKKHRMRRHESICPTLSDCTSSSPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syngr1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
45969114 3x 1.0 µg

Syngr1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
MED18 Recombinant Protein (Mouse)
RP150044 100 µg

MED18 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
RILP (NM_031430) Human Tagged Lenti ORF Clone
RC206400L4 10 µg

RILP (NM_031430) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Tert-Butyl 4-methyl-4- (methylamino) piperidine-1-carboxylate
OR1064649-01 100 mg

Tert-Butyl 4-methyl-4- (methylamino) piperidine-1-carboxylate

Sign In for Pricing
View Details
Tert-Butyl 4-methyl-4- (methylamino) piperidine-1-carboxylate
OR1064649-02 250 mg

Tert-Butyl 4-methyl-4- (methylamino) piperidine-1-carboxylate

Sign In for Pricing
View Details
Tert-Butyl 4-methyl-4- (methylamino) piperidine-1-carboxylate
OR1064649-03 1 g

Tert-Butyl 4-methyl-4- (methylamino) piperidine-1-carboxylate

Sign In for Pricing
View Details