Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Secretory calcium-binding phosphoprotein proline-glutamine rich 1 (SCPPQ)

This Recombinant Human Secretory calcium-binding phosphoprotein proline-glutamine rich 1 (SCPPQ) spans the amino acid sequence from region 16-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Secretory calcium-binding phosphoprotein proline-glutamine rich 1 SCPPPQ1

UniProt

A0A411D538

Expression Region

16-79

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LPIPLEQYAESSSEQRFIFYPPQVPPFFPQVLFPLPPQPPLVLTPNDLIALLIAILNQLGILFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-RFA2 (Thr21) Antibody
MBS9600954-01 0.1 mL

Phospho-RFA2 (Thr21) Antibody

Sign In for Pricing
View Details
Phospho-RFA2 (Thr21) Antibody
MBS9600954-02 0.2 mL

Phospho-RFA2 (Thr21) Antibody

Sign In for Pricing
View Details
Phospho-RFA2 (Thr21) Antibody
MBS9600954-03 5x 0.2 mL

Phospho-RFA2 (Thr21) Antibody

Sign In for Pricing
View Details
Gossypol
N2135-50 50 mg

Gossypol

Sign In for Pricing
View Details
Caspase-8 (8CSP02) : m-IgG1 BP-HRP Bundle
sc-545110 1 Kit

Caspase-8 (8CSP02) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
SDC3 Rabbit Polyclonal Antibody
JOT-AP04673-01 20 µL

SDC3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details