Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Embryonic testis differentiation protein homolog A (ETDA)

This Recombinant Human Embryonic testis differentiation protein homolog A (ETDA) spans the amino acid sequence from region 1-59. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Embryonic testis differentiation protein homolog A ETDA

UniProt

Q3ZM63

Expression Region

1-59

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDKEVPKGSPREPALNIKKSDKSFKRKKPTENVLIFLINRQLGRHRSDIDLSRWVWMLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF488A conjugate, 0.1mg/mL
BNC880324-500 1x 500 µL

CD53 (161-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF640R conjugate, 0.1mg/mL
BNC400851-500 1x 500 µL

HSP60 (LK1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL
BNC740003-500 1x 500 µL

CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL
BNC470304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL
BNC880040-100 1x 100 µL

CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL
BNC400146-100 1x 100 µL

CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details