Recombinant Human Embryonic testis differentiation protein homolog A (ETDA)
This Recombinant Human Embryonic testis differentiation protein homolog A (ETDA) spans the amino acid sequence from region 1-59. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Embryonic testis differentiation protein homolog A ETDA
UniProt
Q3ZM63
Expression Region
1-59
Origin
Homo sapiens (Human)
Field of Research
Stem Cell & Developmental Biology
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MDKEVPKGSPREPALNIKKSDKSFKRKKPTENVLIFLINRQLGRHRSDIDLSRWVWMLS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
26-8123-01 1/Each
Fluorescent Probe, 5'-Tet/3'-BHQ-1; 50 nmols purified yield
Sign In for Pricing
View Details 