Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Doublecortin domain-containing protein 1 (DCDC1), partial, Biotinylated

This Recombinant Human Doublecortin domain-containing protein 1 (DCDC1), partial, Biotinylated spans the amino acid sequence from region 1151-1266. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Doublecortin domain-containing protein 1; Doublecortin domain-containing 5 protein; DCDC1 DCDC5 KIAA1493

UniProt

M0R2J8

Expression Region

1151-1266

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SCSPKHSKLHKHCHQQFEYRDGQIISHAAPQLVLGVQGPNLRSGMEVVLVEKKSDGSHQRWIHQEDSRTFHLVSNPDLVLAVSMTKTRNEVCGYPVIVQKYKPYNNGAANQKWHYM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYT5 CRISPRa sgRNA lentivector (set of three targets)(Human)
46006121 3x 1.0µg DNA

SYT5 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
CRYAA Rabbit pAb
E45R26047N-50 50 µL

CRYAA Rabbit pAb

Sign In for Pricing
View Details
Ametoctradin
TRC-A576375-25MG 25 mg

Ametoctradin

Sign In for Pricing
View Details
(His32,Leu34)-Neuropeptide Y (32-36)
H-3544.0025 25.0mg

(His32,Leu34)-Neuropeptide Y (32-36)

Sign In for Pricing
View Details
CPSF6 (m) -PR
sc-72991-PR 10 µM - 20 µL

CPSF6 (m) -PR

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung: left upper lobe
CS811142 5x 5 µm

Tissue FFPE Sections, Lung: left upper lobe

Sign In for Pricing
View Details