Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein S100-A9 (S10A9), Biotinylated

This Recombinant Human Protein S100-A9 (S10A9), Biotinylated spans the amino acid sequence from region 1-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein S100-A9; Calgranulin-B; Calprotectin L1H subunit; Leukocyte L1 complex heavy chain; Migration inhibitory factor-related protein 14; MRP-14; p14; S100 calcium-binding protein A9; S100A9 CAGB CFAG MRP14

UniProt

P06702

Expression Region

1-114

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4921515J06Rik Protein Vector (Mouse) (pPM-C-His)
PV148929 500 ng

4921515J06Rik Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Human FLNa Matched Antibody Pair Set [ABP-S-051752]
ABP-S-051752 5 Plates

Human FLNa Matched Antibody Pair Set [ABP-S-051752]

Sign In for Pricing
View Details
anti-XRCC4
YF-PA15348 100 ug

anti-XRCC4

Sign In for Pricing
View Details
WDR53 Rabbit Polyclonal Antibody (Biotin)
orb2104417 100 µL

WDR53 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Rat Interleukin 13 (IL13) ELISA Kit
EKN46333 96 Tests

Rat Interleukin 13 (IL13) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal CD45 Antibody (998209) [Janelia Fluor 549]
FAB14301I 0.1 mL

Mouse Monoclonal CD45 Antibody (998209) [Janelia Fluor 549]

Sign In for Pricing
View Details