Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda constant 2 (IGLC2), Biotinylated

This Recombinant Human Immunoglobulin lambda constant 2 (IGLC2), Biotinylated spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda constant 2; Ig lambda chain C region Kern; Ig lambda chain C region NIG-64; Ig lambda chain C region SH; Ig lambda chain C region X; Ig lambda-2 chain C region; IGLC2

UniProt

P0DOY2

Expression Region

1-106

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syntrophin (dystrophin-associated protein A1, 59kD, basic component 1, 59-DAP, 59kD dystrophin-associated protein A1 basic component 1, A1B, Beta-1-syntrophin, BSYN2, DAPA1B, FLJ22442, MGC111389, SNT2, SNT2B1, Syntrophin-2, Tax interaction protein 43, TIP-43) (PE) discontinued
S9299-95B-PE 100 µL

Syntrophin (dystrophin-associated protein A1, 59kD, basic component 1, 59-DAP, 59kD dystrophin-associated protein A1 basic component 1, A1B, Beta-1-syntrophin, BSYN2, DAPA1B, FLJ22442, MGC111389, SNT2, SNT2B1, Syntrophin-2, Tax interaction protein 43, TIP-43) (PE) discontinued

Sign In for Pricing
View Details
CRBN ligand-537
orb3176695-01 50 mg

CRBN ligand-537

Sign In for Pricing
View Details
CRBN ligand-537
orb3176695-02 10 mg

CRBN ligand-537

Sign In for Pricing
View Details
SVOP, NT (SVOP, Synaptic vesicle 2-related protein) (MaxLight 650) discontinued
042502-ML650 100 µL

SVOP, NT (SVOP, Synaptic vesicle 2-related protein) (MaxLight 650) discontinued

Sign In for Pricing
View Details
IRS-1 Antibody (Rabbit)
HY-P81116-01 20 µL

IRS-1 Antibody (Rabbit)

Sign In for Pricing
View Details
IRS-1 Antibody (Rabbit)
HY-P81116-02 50 μL

IRS-1 Antibody (Rabbit)

Sign In for Pricing
View Details