Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda constant 2 (IGLC2), Biotinylated

This Recombinant Human Immunoglobulin lambda constant 2 (IGLC2), Biotinylated spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda constant 2; Ig lambda chain C region Kern; Ig lambda chain C region NIG-64; Ig lambda chain C region SH; Ig lambda chain C region X; Ig lambda-2 chain C region; IGLC2

UniProt

P0DOY2

Expression Region

1-106

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD2 Protein Lysate
MBS139036-01 0.02 mg

Human CD2 Protein Lysate

Sign In for Pricing
View Details
Human CD2 Protein Lysate
MBS139036-02 5x 0.02 mg

Human CD2 Protein Lysate

Sign In for Pricing
View Details
KLHL9 Polyclonal Antibody, APC Conjugated
bs-7753R-APC 100 µL

KLHL9 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Histone H2A.Z Recombinant Rabbit mAb
BS48056-01 50 µL

Histone H2A.Z Recombinant Rabbit mAb

Sign In for Pricing
View Details
Histone H2A.Z Recombinant Rabbit mAb
BS48056-02 100 µL

Histone H2A.Z Recombinant Rabbit mAb

Sign In for Pricing
View Details
Mouse Monoclonal Desmoglein-3 Antibody (DSG3/2837) [DyLight 594]
NBP3-08411DL594 100 µL

Mouse Monoclonal Desmoglein-3 Antibody (DSG3/2837) [DyLight 594]

Sign In for Pricing
View Details