Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-adrenomedullin (ADML), partial, Biotinylated

This Recombinant Human Pro-adrenomedullin (ADML), partial, Biotinylated spans the amino acid sequence from region 95-146. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pro-adrenomedullin [Cleaved into: Adrenomedullin; AM; Proadrenomedullin N-20 terminal peptide; ProAM N-terminal 20 peptide; PAMP; ProAM-N20] ADM AM

UniProt

P35318

Expression Region

95-146

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CREBRF Antibody
CTA1989-01 30 µL

Anti-CREBRF Antibody

Sign In for Pricing
View Details
Anti-CREBRF Antibody
CTA1989-02 50 μL

Anti-CREBRF Antibody

Sign In for Pricing
View Details
Anti-CREBRF Antibody
CTA1989-03 100 µL

Anti-CREBRF Antibody

Sign In for Pricing
View Details
Anti-CREBRF Antibody
CTA1989-04 200 µL

Anti-CREBRF Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal COMMD9 Antibody [mFluor Violet 450 SE]
NBP3-00330MFV450 0.1 mL

Rabbit Polyclonal COMMD9 Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
1-Decanol
581744 50.0g

1-Decanol

Sign In for Pricing
View Details