Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Collagen alpha-1 (X) chain (COAA1), Biotinylated

This Recombinant Human Collagen alpha-1 (X) chain (COAA1), Biotinylated spans the amino acid sequence from region 19-680. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Collagen alpha-1 (X; chain COL10A1

UniProt

Q03692

Expression Region

19-680

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VFYAERYQMPTGIKGPLPNTKTQFFIPYTIKSKGIAVRGEQGTPGPPGPAGPRGHPGPSGPPGKPGYGSPGLQGEPGLPGPPGPSAVGKPGVPGLPGKPGERGPYGPKGDVGPAGLPGPRGPPGPPGIPGPAGISVPGKPGQQGPTGAPGPRGFPGEKGAPGVPGMNGQKGEMGYGAPGRPGERGLPGPQGPTGPSGPPGVGKRGENGVPGQPGIKGDRGFPGEMGPIGPPGPQGPPGERGPEGIGKPGAAGAPGQPGIPGTKGLPGAPGIAGPPGPPGFGKPGLPGLKGERGPAGLPGGPGAKGEQGPAGLPGKPGLTGPPGNMGPQGPKGIPGSHGLPGPKGETGPAGPAGYPGAKGERGSPGSDGKPGYPGKPGLDGPKGNPGLPGPKGDPGVGGPPGLPGPVGPAGAKGMPGHNGEAGPRGAPGIPGTRGPIGPPGIPGFPGSKGDPGSPGPPGPAGIATKGLNGPTGPPGPPGPRGHSGEPGLPGPPGPPGPPGQAVMPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPRTGIFTCQIPGIYYFSYHVHVKGTHVWVGLYKNGTPVMYTYDEYTKGYLDQASGSAIIDLTENDQVWLQLPNAESNGLYSSEYVHSSFSGFLVAPM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIST1H2BJ Protein Vector (Mouse) (pPM-C-HA)
PV188824 500 ng

HIST1H2BJ Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Cat Desmoyokin ELISA Kit
MBS068676 Inquire

Cat Desmoyokin ELISA Kit

Sign In for Pricing
View Details
KCNJ8, NT (KCNJ8, ATP-sensitive inward rectifier potassium channel 8, Inward rectifier K (+) channel Kir6.1, Potassium channel, inwardly rectifying subfamily J member 8, uKATP-1) (FITC) discontinued
037331-FITC 200 µL

KCNJ8, NT (KCNJ8, ATP-sensitive inward rectifier potassium channel 8, Inward rectifier K (+) channel Kir6.1, Potassium channel, inwardly rectifying subfamily J member 8, uKATP-1) (FITC) discontinued

Sign In for Pricing
View Details
Factor I (CFI) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI15H9]
TA806029BM 100 µL

Factor I (CFI) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI15H9]

Sign In for Pricing
View Details
Z-Pro-Pro-OH
sc-473635 1 g

Z-Pro-Pro-OH

Sign In for Pricing
View Details
DR6 (TNFRSF21) Rabbit Polyclonal Antibody
TA306010 100 µg

DR6 (TNFRSF21) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details