Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Acetylcholine receptor subunit delta (ACHD), partial, Biotinylated

This Recombinant Human Acetylcholine receptor subunit delta (ACHD), partial, Biotinylated spans the amino acid sequence from region 22-245. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Acetylcholine receptor subunit delta CHRND ACHRD

UniProt

Q07001

Expression Region

22-245

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LNEEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEETLTTNVWIEHGWTDNRLKWNAEEFGNISVLRLPPDMVWLPEIVLENNNDGSFQISYSCNVLVYHYGFVYWLPPAIFRSSCPISVTYFPFDWQNCSLKFSSLKYTAKEITLSLKQDAKENRTYPVEWIIIDPEGFTENGEWEIVHRPARVNVDPRAPLDSPSRQDITFYLIIRRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FAM126B shRNA (UAS) - Lentiviral human FAM126B shRNA (UAS) plasmid
GTR15347254 1 Vial

Lentiviral human FAM126B shRNA (UAS) - Lentiviral human FAM126B shRNA (UAS) plasmid

Sign In for Pricing
View Details
GBAS Overexpression Lysate (Native) - (Dry Ice)
NBL1-10993 0.1 mg

GBAS Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Recombinant Human Fibroblast Growth Factor 1 (FGF1)
MBS7114973-01 0.01 mg

Recombinant Human Fibroblast Growth Factor 1 (FGF1)

Sign In for Pricing
View Details
Recombinant Human Fibroblast Growth Factor 1 (FGF1)
MBS7114973-02 0.05 mg

Recombinant Human Fibroblast Growth Factor 1 (FGF1)

Sign In for Pricing
View Details
Recombinant Human Fibroblast Growth Factor 1 (FGF1)
MBS7114973-03 0.5 mg

Recombinant Human Fibroblast Growth Factor 1 (FGF1)

Sign In for Pricing
View Details
Recombinant Human Fibroblast Growth Factor 1 (FGF1)
MBS7114973-04 1 mg

Recombinant Human Fibroblast Growth Factor 1 (FGF1)

Sign In for Pricing
View Details